PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_009CBDD14.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 803aa    MW: 84411.3 Da    PI: 6.5081
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_009CBDD14.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095976341954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Traes_4DS_009CBDD14.1 597 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 634
                            554459******************************88 PP

2BELL118.63e-38458528272
                   BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            r e q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Traes_4DS_009CBDD14.1 458 RFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 528
                            6799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF504944.58E-7149236IPR009003Peptidase S1, PA clan
SMARTSM005747.2E-67382526IPR006563POX domain
PfamPF075262.2E-52387525IPR006563POX domain
PROSITE profilePS5007112.6575638IPR001356Homeobox domain
SMARTSM003891.5E-9578642IPR001356Homeobox domain
CDDcd000863.59E-13578639No hitNo description
SuperFamilySSF466893.12E-17580645IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-28581644IPR009057Homeodomain-like
PfamPF059204.1E-18595634IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MPCAVVADEL VSGCCGRSKG IFLGADDDDD DSGAAGMGIA APPCQQTTTR QVSATTSSAA  60
IYGGRPATAS SMSHSQGFHQ GSSGVYGFSS DGFDRPGSSQ DHDQQQEQQQ HHVAQQSRRD  120
KMRVQGFDPA AAAAHGLLPI DGDEHVEPGA MYDHAAAAGA SNMLAEMFNF SAQTPSGPSA  180
TELLASQMNA NYRFGFRQQA PGAVVAGLPG DGGWFGSGGP GRAGVVLGGA NLLGETSSPK  240
QQAGGMAGLA TDPAAAMQLF LMNPQQQQQS RSSPPSPPPS DAQSAIQHHE AFQAYGNAAS  300
SFGGGGAGVV EGQGLSLSLS PSLQQLEMAK QAEELRVRDG VLYFNRQQQQ QQQAPSVQQL  360
PMALHGQVGT MGQQLHVGYG PAGVAGVLRN SKYTRAAQEL LDEFCSVGRG QTIKGGGRGA  420
GGSSSNPNAS KGGPSSSGAA QSPSSASKEP PQLSPADRFE QQRKKAKLIS MLDEVDRRYN  480
HYCDQMQMVV NFFDSVMGFG AATPYTALAQ KAMSRHFRCL KDAIAAQLRH TCELLGEKDA  540
GTSSGLTKGE TPRLRAIDQS LRQQRAFHHM GMMEQEAWRP QRGLPERSVS ILRSWLFEHF  600
LHPYPSDADK HLLARQTGLS RNQVSNWFIN ARVRLWKPMI EEMYQQETKE LEGSSAGGGG  660
GGPESGNDPS GADDLHSPTT TGAQQHPQQQ VVMQHGGGRY GQQEHGMSGV HPHKLDPGAG  720
PSVADAAFVG LDPAELLGGD AHVGAADDLY GRFEPGVRMR YGPAATGAVS GDVSLTLGLQ  780
HAGAGNQGPD GSGRFSLRDY NGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17584641158Homeobox protein Meis1
4xrs_B7e-17584641158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466420.0AB546642.1 Triticum aestivum WBLH1-2 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLW5ENJ50.0W5ENJ5_WHEAT; Uncharacterized protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-124BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]